DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ac and LOC1272964

DIOPT Version :10

Sequence 1:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster
Sequence 2:XP_311895.4 Gene:LOC1272964 / 1272964 VectorBaseID:AGAMI1_008652 Length:200 Species:Anopheles gambiae


Alignment Length:77 Identity:23/77 - (29%)
Similarity:33/77 - (42%) Gaps:5/77 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RLESDVQPEGYNFALETSDGKKHEEQGQLKNVGTEQEAIVVRGSYSFVADDGQTYTVNYIADE-N 93
            |..||...:.|::.....|    |..|.:|:....:....|||.|..:..||....|:|.||: .
Mosquito    81 RESSDYDRDDYSYGYAVRD----ELSGDIKSQQEVRNGDRVRGQYRTLESDGTERIVDYTADDVR 141

  Fly    94 GFQPEGAHLPNV 105
            ||.....|.|:|
Mosquito   142 GFNAVVRHQPSV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:459790 15/55 (27%)
LOC1272964XP_311895.4 None

Return to query results.
Submit another query.