DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ad and Cpr65Ay

DIOPT Version :10

Sequence 1:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001097524.1 Gene:Cpr65Ay / 5740348 FlyBaseID:FBgn0085300 Length:109 Species:Drosophila melanogaster


Alignment Length:81 Identity:24/81 - (29%)
Similarity:37/81 - (45%) Gaps:16/81 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EGYKFAVETSDGKSHQEEGQL------------KDVGTDHEAIVVRGSYAYVGDDGQTYSIQYLA 91
            |...|...|.:|  ||....:            |:| |..:.:..:|.|:::..||..|.:.|.|
  Fly    29 EKLHFGFHTENG--HQRNEAITYTVKPETVQDPKEV-TTQKPVEYKGGYSFISADGYEYQVLYKA 90

  Fly    92 DENGFQP-EGAHLPRP 106
            ::||||| ..||..:|
  Fly    91 NKNGFQPYVTAHKIKP 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 16/66 (24%)
Cpr65AyNP_001097524.1 Chitin_bind_4 33..95 CDD:459790 16/64 (25%)

Return to query results.
Submit another query.