DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ad and Lcp65Af

DIOPT Version :10

Sequence 1:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster


Alignment Length:104 Identity:56/104 - (53%)
Similarity:72/104 - (69%) Gaps:9/104 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFTIAIAFTCILACSLAAPPAIQQDAQVLRFDSDVLPEGYKFAVETSDGKSHQEEGQLKDVGTD 65
            |||  .|.|..:.|.::|       |.|:|:.:|||.|..:.:..|||||.|.|..||||:||||
  Fly     1 MKF--LIVFVALFALAVA-------DVQILKQESDVGPVSFNYGYETSDGSSAQAAGQLKNVGTD 56

  Fly    66 HEAIVVRGSYAYVGDDGQTYSIQYLADENGFQPEGAHLP 104
            .||:.|:|:|::|.||||||||.|.|||||:||:|||||
  Fly    57 EEALNVKGTYSFVADDGQTYSIAYTADENGYQPQGAHLP 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 34/54 (63%)
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 34/54 (63%)

Return to query results.
Submit another query.