DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ad and Ccp84Af

DIOPT Version :10

Sequence 1:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:82 Identity:27/82 - (32%)
Similarity:39/82 - (47%) Gaps:9/82 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 APPAIQQDAQVL---RFDSDVLPEGYKFAVETSDGKSHQEEGQLKDVGTDHEAIVVRGSYAYVGD 80
            ||.|:.....||   ..:.|..|: ||||.:..|..|...:.|:::...|    ||.|.|:.:..
  Fly    38 APVAVAHAQPVLTKATEEYDPHPQ-YKFAYDVQDSLSGDSKSQVEERDGD----VVHGEYSLIDS 97

  Fly    81 DGQTYSIQYLADE-NGF 96
            ||....:||.:|. |||
  Fly    98 DGYKRIVQYTSDPVNGF 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 18/55 (33%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 18/55 (33%)

Return to query results.
Submit another query.