DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ad and Cpr73D

DIOPT Version :10

Sequence 1:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_001097627.1 Gene:Cpr73D / 39897 FlyBaseID:FBgn0036680 Length:597 Species:Drosophila melanogaster


Alignment Length:96 Identity:27/96 - (28%)
Similarity:41/96 - (42%) Gaps:26/96 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PAIQQDAQVLRFDSDVLPEG--------------YKFAVETSDGKSHQEEGQLKDVGTDHEAIVV 71
            |.|.:...:.::  .|||.|              |.|:..|.| :|..||   .|.|..     :
  Fly    95 PKIHRKMDLAQY--PVLPRGSPDDPLADPFDDPSYSFSFRTPD-QSRSEE---NDSGNR-----I 148

  Fly    72 RGSYAYVGDDGQTYSIQYLADE-NGFQPEGA 101
            ||.|:|:.|.|:.:|::|.|.. .||:...|
  Fly   149 RGLYSYLDDVGERHSVRYAAGAGTGFEISNA 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 18/55 (33%)
Cpr73DNP_001097627.1 Chitin_bind_4 127..174 CDD:459790 18/55 (33%)
Chitin_bind_4 <223..257 CDD:459790
SASA 491..>579 CDD:427409
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.