DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ad and Cpr65Ec

DIOPT Version :10

Sequence 1:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster


Alignment Length:110 Identity:40/110 - (36%)
Similarity:54/110 - (49%) Gaps:19/110 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KFTI----AIAFTCILACSLAAPPAIQQDAQVLRFDSDVLPEG-YKFAVETSDGKSHQEEGQLKD 61
            ||.:    |:|.:|:.|.|..|      .|:...:.||:..:| |.:..:||:|.:.||.|    
  Fly     3 KFFVLAVAALAVSCVQADSFDA------RAETREYKSDLKEDGSYAYQYQTSNGIAGQESG---- 57

  Fly    62 VGTDHEAIVVRGSYAYVGDDGQTYSIQYLADENGFQPEGAHLPRP 106
            ||    .....||.||...|||...:.|.||.||:.|.|||||.|
  Fly    58 VG----GYYASGSNAYYAPDGQLIQLTYTADSNGYHPAGAHLPTP 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 20/54 (37%)
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:459790 20/54 (37%)

Return to query results.
Submit another query.