DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ad and Acp65Aa

DIOPT Version :9

Sequence 1:NP_001261466.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster


Alignment Length:106 Identity:50/106 - (47%)
Similarity:70/106 - (66%) Gaps:3/106 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFTIAIAFTCILACSLAAPPAIQQDAQVLRFDSDVLP-EGYKFAVETSDGKSHQEEGQLKDVGT 64
            ||..:.:....:|....:|.|  |.|.:||.::|:... .||||:.:.|||.|..|||.:.:.||
  Fly     2 MKLMLVVGSIALLLALASARP--QNDVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAGT 64

  Fly    65 DHEAIVVRGSYAYVGDDGQTYSIQYLADENGFQPEGAHLPR 105
            |:|:|.:|||..:|..|||||:|.::||||||||||||||:
  Fly    65 DNESISIRGSVTWVAPDGQTYTINFVADENGFQPEGAHLPK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AdNP_001261466.1 Chitin_bind_4 41..96 CDD:278791 29/54 (54%)
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:278791 29/54 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466924
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27015
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.