DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ad and Cpr62Bb

DIOPT Version :10

Sequence 1:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_647667.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster


Alignment Length:91 Identity:26/91 - (28%)
Similarity:41/91 - (45%) Gaps:10/91 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FTC--ILACSLAAPPAIQQDAQVLRFDSDVLPEGYKFAVETSDGKSHQEEGQLKDVGTDHEAIVV 71
            |.|  ||:.:|.|..|:.:....|.:...  |: |.|    :.|.:....|.:|......:..||
  Fly     4 FVCFVILSLALFASVAVARPGYALDYYDH--PK-YAF----NYGVADHSTGDVKSQHETRDGDVV 61

  Fly    72 RGSYAYVGDDGQTYSIQYLADE-NGF 96
            :|.|:.|..||...::.|.||. :||
  Fly    62 KGQYSLVEPDGSIRTVDYTADSIHGF 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 15/55 (27%)
Cpr62BbNP_647667.1 Chitin_bind_4 35..87 CDD:459790 15/55 (27%)

Return to query results.
Submit another query.