DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ad and Cpr57A

DIOPT Version :10

Sequence 1:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster


Alignment Length:105 Identity:30/105 - (28%)
Similarity:45/105 - (42%) Gaps:27/105 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FTCILACSLAAPPAIQQDAQVLRFDSDVLPE------GYKFAVETSDGKSHQEEGQLKDVGTDHE 67
            |..::.|.||...|   |...|     |.||      .|.|:.:......|        |...|.
  Fly     2 FIVLVVCLLAVAAA---DVSHL-----VTPEPKVPASPYVFSYQAGRAPGH--------VDRQHT 50

  Fly    68 AI-----VVRGSYAYVGDDGQTYSIQYLADENGFQPEGAH 102
            .:     |:||:::||....|..::||:|||:||.|:.:|
  Fly    51 EVSDGSGVIRGAFSYVDPKNQVRTVQYVADEHGFHPQLSH 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 16/59 (27%)
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 16/59 (27%)

Return to query results.
Submit another query.