DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ad and Cpr49Ac

DIOPT Version :10

Sequence 1:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster


Alignment Length:67 Identity:23/67 - (34%)
Similarity:36/67 - (53%) Gaps:5/67 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YKFAVETSDGKSHQEEGQLKDVGTDHEAIVVRGSYAYVGDDGQTYSIQYLADENGFQPEGAHL-P 104
            |..:..|.:|...:|:.:|...|..|    .:|.|.|.||||:.|.:.|.:::.||.|:|.|: |
  Fly   175 YDHSYLTENGIYGEEQAKLHHTGGTH----AKGFYEYTGDDGKLYRVNYASNDGGFMPQGDHIHP 235

  Fly   105 RP 106
            .|
  Fly   236 IP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 16/54 (30%)
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:459790 16/54 (30%)

Return to query results.
Submit another query.