DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ad and Cpr47Ef

DIOPT Version :10

Sequence 1:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_610660.2 Gene:Cpr47Ef / 36194 FlyBaseID:FBgn0033603 Length:612 Species:Drosophila melanogaster


Alignment Length:89 Identity:37/89 - (41%)
Similarity:52/89 - (58%) Gaps:1/89 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 APPAIQQDAQVLRFDSDVLPEG-YKFAVETSDGKSHQEEGQLKDVGTDHEAIVVRGSYAYVGDDG 82
            |||.......:|.|.::...:| |:|:.||.:|...||||.:|:.|:::|...|.|||:|...:|
  Fly   126 APPTSGPPIPILSFVNENDGDGNYRFSYETGNGIKAQEEGTVKNKGSENEIPSVMGSYSYTNPEG 190

  Fly    83 QTYSIQYLADENGFQPEGAHLPRP 106
            :...|.|.||||||.|.|..||.|
  Fly   191 ELVEIMYTADENGFVPSGNALPTP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 24/54 (44%)
Cpr47EfNP_610660.2 Chitin_bind_4 149..204 CDD:459790 24/54 (44%)

Return to query results.
Submit another query.