DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ad and Pcp

DIOPT Version :9

Sequence 1:NP_001261466.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster


Alignment Length:106 Identity:35/106 - (33%)
Similarity:60/106 - (56%) Gaps:10/106 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFTIAIAFTCILACSLAAPPAIQQDAQVLRFDSDVLPEG-YKFAVETSDGKSHQEEGQLKDVGT 64
            :.|.:|:|...:.|.|...|.: .::.:.|:.|..|..:| |::|.|||:|.|..:||    :| 
  Fly     5 VNFIVALAVLQVQAGSSYIPDS-DRNTRTLQNDLQVERDGKYRYAYETSNGISASQEG----LG- 63

  Fly    65 DHEAIVVRGSYAYVGDDGQTYSIQYLADENGFQPEGAHLPR 105
               .:.|:|..:|...:|:..|:.|:|||.|:.|.|||:|:
  Fly    64 ---GVAVQGGSSYTSPEGEVISVNYVADEFGYHPVGAHIPQ 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AdNP_001261466.1 Chitin_bind_4 41..96 CDD:278791 19/54 (35%)
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:278791 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.