DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ad and LOC3290497

DIOPT Version :10

Sequence 1:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster
Sequence 2:XP_551141.2 Gene:LOC3290497 / 3290497 VectorBaseID:AGAMI1_005151 Length:712 Species:Anopheles gambiae


Alignment Length:127 Identity:34/127 - (26%)
Similarity:45/127 - (35%) Gaps:44/127 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KFTIAIAFTCILACSLAAPPAIQ--------------------------QDAQVLRFDSDVLPEG 40
            ||.|..|...:....|.|.||:.                          ..||...:|::  |: 
Mosquito   267 KFVIFAAVVAVARAGLIASPAVSYAAAPALVAAPVAKVAYAAAPIAKVAYAAQPEEYDAN--PQ- 328

  Fly    41 YKFA-----VETSDGKSHQEEGQLKDVGTDHEAIVVRGSYAYVGDDGQTYSIQYLAD-ENGF 96
            |.|:     ..|.|.||.||         .....||:|||:.|..||...::.|.|| .|||
Mosquito   329 YSFSYGISDALTGDSKSQQE---------SRSGDVVQGSYSVVDPDGTKRTVDYTADPHNGF 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 20/60 (33%)
LOC3290497XP_551141.2 None

Return to query results.
Submit another query.