DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ad and Cpr11B

DIOPT Version :9

Sequence 1:NP_001261466.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster


Alignment Length:84 Identity:36/84 - (42%)
Similarity:51/84 - (60%) Gaps:4/84 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QQDAQ--VLRFDSDVLPEG-YKFAVETSDGKSHQEEGQLKDVGTDHEAIVVRGSYAYVGDDGQTY 85
            ||..|  ::|.|.:....| |.|..:|.:|....|.|:.:. |..|.::.|:|||:|.||||:.|
  Fly    65 QQQPQIPIVRSDYNSDANGNYNFGFDTGNGIHRDETGEFRG-GWPHGSLGVQGSYSYTGDDGKQY 128

  Fly    86 SIQYLADENGFQPEGAHLP 104
            ::.|.||:|||..||||||
  Fly   129 TVNYTADKNGFHAEGAHLP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AdNP_001261466.1 Chitin_bind_4 41..96 CDD:278791 22/54 (41%)
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 22/54 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508073at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.