DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ad and LOC1276676

DIOPT Version :10

Sequence 1:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster
Sequence 2:XP_316046.3 Gene:LOC1276676 / 1276676 VectorBaseID:AGAMI1_011765 Length:147 Species:Anopheles gambiae


Alignment Length:67 Identity:29/67 - (43%)
Similarity:45/67 - (67%) Gaps:1/67 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YKFAVETSDGKSHQEEGQLKDVGT-DHEAIVVRGSYAYVGDDGQTYSIQYLADENGFQPEGAHLP 104
            |||..|:::|.:.||:|.:|:.|: |||..|..|.::|....|...|:.|:|||:|||.:|:|:|
Mosquito    44 YKFGYESANGIAAQEQGFVKNGGSKDHEVQVAHGYFSYTDPHGHPVSLSYVADEHGFQAKGSHIP 108

  Fly   105 RP 106
            .|
Mosquito   109 TP 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 22/55 (40%)
LOC1276676XP_316046.3 None

Return to query results.
Submit another query.