DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ad and LOC1276669

DIOPT Version :10

Sequence 1:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster
Sequence 2:XP_316039.1 Gene:LOC1276669 / 1276669 VectorBaseID:AGAMI1_000057 Length:109 Species:Anopheles gambiae


Alignment Length:104 Identity:49/104 - (47%)
Similarity:72/104 - (69%) Gaps:3/104 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAIAFTCILACSLAA--PPAIQQDAQVLRFDSDVLP-EGYKFAVETSDGKSHQEEGQLKDVGTDH 66
            :.:.|..:||...||  |.|.::|||:|::::|... :||.|..:||:|...||:.|||....::
Mosquito     6 VILLFAGLLALGYAAPRPGAEEKDAQLLKYENDHNGIDGYNFQFDTSNGIQRQEQAQLKQFDDEN 70

  Fly    67 EAIVVRGSYAYVGDDGQTYSIQYLADENGFQPEGAHLPR 105
            .|:||||||::.|||||.|::.|:|||||||||..|||:
Mosquito    71 AALVVRGSYSFTGDDGQVYTVNYVADENGFQPEAPHLPK 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 28/54 (52%)
LOC1276669XP_316039.1 Chitin_bind_4 45..100 CDD:459790 28/54 (52%)

Return to query results.
Submit another query.