DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ad and Cpr62Bb

DIOPT Version :10

Sequence 1:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster
Sequence 2:XP_308913.3 Gene:Cpr62Bb / 1270233 VectorBaseID:AGAMI1_003915 Length:169 Species:Anopheles gambiae


Alignment Length:102 Identity:26/102 - (25%)
Similarity:38/102 - (37%) Gaps:30/102 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TIAIAFTCILACSLAAPPAIQQDAQVLRFDSDVLPEGYKFAVETSD--------GKSHQEEGQLK 60
            |:.:|.....:.:||.|                   ||  ||:..|        |.:....|.:|
Mosquito     8 TLLLALAMFGSSALARP-------------------GY--AVDYYDHPKYAFNYGVADHSTGDVK 51

  Fly    61 DVGTDHEAIVVRGSYAYVGDDGQTYSIQYLADE-NGF 96
            ......:..||:|.|:.|..||...::.|.||. |||
Mosquito    52 SQHETRDGDVVKGQYSLVEPDGSVRTVDYTADPINGF 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 18/63 (29%)
Cpr62BbXP_308913.3 Chitin_bind_4 36..88 CDD:459790 14/51 (27%)
DamX <92..145 CDD:442497
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.