DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Cpr65Au

DIOPT Version :9

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001286953.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster


Alignment Length:93 Identity:34/93 - (36%)
Similarity:55/93 - (59%) Gaps:5/93 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFGLILVSFCACSSNATDT-AQILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEE--A 68
            |...:.:..|.......|. |:.::.::|| ..|.|:|::|||:||||.|...:| ||..||  :
  Fly     8 LVAFLAIGICLAFPAGEDAQAETIKLESEN-TGDKYSFAYETSNGISRTETGEVK-PGAGEEDGS 70

  Fly    69 IAIQGSVHWVGPDGIHYKLNYLADENGF 96
            :::|||..|..|||..|::::.|||.|:
  Fly    71 LSVQGSTSWSAPDGKKYEISFTADETGY 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:278791 26/56 (46%)
Cpr65AuNP_001286953.1 Chitin_bind_4 42..98 CDD:278791 26/56 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508073at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.