DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Lcp65Ab2

DIOPT Version :9

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_788469.1 Gene:Lcp65Ab2 / 48381 FlyBaseID:FBgn0020643 Length:104 Species:Drosophila melanogaster


Alignment Length:98 Identity:36/98 - (36%)
Similarity:57/98 - (58%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FGLILVSFCACSSNATDTAQILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEAIAIQ 72
            |.::.|:..|.:....:.|:|:|..:: ::.:.::...|||||.|.::...|||.||..||..:.
  Fly     3 FLIVFVALFAMAVARPNLAEIVRQVSD-VEPEKWSSDVETSDGTSIKQEGVLKNAGTDNEAAVVH 66

  Fly    73 GSVHWVG-PDGIHYKLNYLADENGFQAQGEHLP 104
            ||..||. ..|..:.:.|:|||||:|.||.|||
  Fly    67 GSFTWVDEKTGEKFTITYVADENGYQPQGAHLP 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:278791 23/55 (42%)
Lcp65Ab2NP_788469.1 Chitin_bind_4 40..91 CDD:306811 23/50 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.