DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and LOC4578367

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:XP_001238133.1 Gene:LOC4578367 / 4578367 VectorBaseID:AGAMI1_005911 Length:187 Species:Anopheles gambiae


Alignment Length:72 Identity:17/72 - (23%)
Similarity:32/72 - (44%) Gaps:6/72 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHYKLNYLAD 92
            ::::.:|:.|:. |.||:    |:..:....:|..........:.|....:..||....:.|.||
Mosquito    62 LVKHIDEDHDAQ-YDFSY----GVHDDHTGDIKEQRESRHGDQVHGQYSLIDSDGHKRTVEYTAD 121

  Fly    93 E-NGFQA 98
            : |||.|
Mosquito   122 DHNGFNA 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 12/55 (22%)
LOC4578367XP_001238133.1 Chitin_bind_4 74..126 CDD:459790 12/55 (22%)

Return to query results.
Submit another query.