DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and LOC4576978

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:XP_001230823.3 Gene:LOC4576978 / 4576978 VectorBaseID:AGAMI1_002998 Length:187 Species:Anopheles gambiae


Alignment Length:59 Identity:18/59 - (30%)
Similarity:27/59 - (45%) Gaps:5/59 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHYKLNYLADE-NGFQA 98
            |::|:..:|.::.:.    ||.........:.||...|.|||....:.|.||. |||.|
Mosquito    85 YSYSYAVADAVTGDN----KNQQESRSGDVVTGSYSLVEPDGTRRTVEYNADPINGFNA 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 15/55 (27%)
LOC4576978XP_001230823.3 None

Return to query results.
Submit another query.