DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and LOC4576733

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:XP_001237148.2 Gene:LOC4576733 / 4576733 VectorBaseID:AGAMI1_004026 Length:143 Species:Anopheles gambiae


Alignment Length:75 Identity:16/75 - (21%)
Similarity:27/75 - (36%) Gaps:5/75 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DSDGYAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHYKLNYLAD-ENGFQAQG 100
            |...|.|.:    |:........|......:...::|.......||....::|.:| .|||:|..
Mosquito    30 DHPKYKFEY----GVKDPHTGDHKTQWEVRDGDVVKGQYTLHEADGTERVVDYKSDGHNGFEADV 90

  Fly   101 EHLPQVEHSS 110
            :.:....|.|
Mosquito    91 KKVGHAHHPS 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 10/55 (18%)
LOC4576733XP_001237148.2 Chitin_bind_4 34..86 CDD:459790 10/55 (18%)

Return to query results.
Submit another query.