DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Cpr97Ea

DIOPT Version :9

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster


Alignment Length:78 Identity:21/78 - (26%)
Similarity:35/78 - (44%) Gaps:8/78 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DTAQILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHYKLN 88
            |...||:..|::.:...|.:.:|.:||..:.|...    .|.|    ::|...:|...|....:.
  Fly    55 DPVAILKQINKHNEDGSYTYGYEGADGSFKIETKL----ATGE----VKGKYGYVDETGKVRVVE 111

  Fly    89 YLADENGFQAQGE 101
            |.|::.|||..||
  Fly   112 YGANKYGFQPSGE 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:278791 12/54 (22%)
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:278791 12/54 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.