DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Ccp84Ab

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster


Alignment Length:70 Identity:21/70 - (30%)
Similarity:28/70 - (40%) Gaps:9/70 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YAFSFETSDGISREERATLKNPGTPEE--AIAIQGSVHWVGPDGIHYKLNYLADE-NGFQAQGEH 102
            |.||:...|      :.|..|.|..||  ...::|....:..||....:.|.||. |||.|....
  Fly    62 YRFSYGVDD------KLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNR 120

  Fly   103 LPQVE 107
            .|.|:
  Fly   121 EPLVK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 16/57 (28%)
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:459790 16/57 (28%)

Return to query results.
Submit another query.