DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Ccp84Ac

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster


Alignment Length:71 Identity:19/71 - (26%)
Similarity:32/71 - (45%) Gaps:7/71 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHYKLNYLADE-NGFQA--QGEH 102
            |.|:::..|.:|.:.::.:::    .:...:||.......||....:.|.||. |||.|  ..|.
  Fly    65 YNFAYDVQDALSGDSKSQVES----RDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREP 125

  Fly   103 LPQVEH 108
            |..|.|
  Fly   126 LAHVHH 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 12/55 (22%)
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:459790 12/55 (22%)

Return to query results.
Submit another query.