DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Ccp84Ad

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster


Alignment Length:68 Identity:15/68 - (22%)
Similarity:31/68 - (45%) Gaps:5/68 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHYKLNYLADE-NGFQAQGEHLP 104
            |.::::..|.:|.:.::.::.    .:...::|....:..||....:.|.||. |||.|.....|
  Fly    62 YKYAYDVQDSLSGDSKSQVEE----RDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREP 122

  Fly   105 QVE 107
            .|:
  Fly   123 LVK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 10/55 (18%)
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 10/55 (18%)

Return to query results.
Submit another query.