DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Ccp84Ae

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster


Alignment Length:61 Identity:18/61 - (29%)
Similarity:27/61 - (44%) Gaps:9/61 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YAFSFETSDGISREERATLKNPGTPEE--AIAIQGSVHWVGPDGIHYKLNYLADE-NGFQA 98
            |.:|::..|.:|.:      |.|..||  ...::|....:..||....:.|.||. |||.|
  Fly    51 YTYSYDVQDTLSGD------NKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNA 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 15/57 (26%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 15/57 (26%)

Return to query results.
Submit another query.