DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Ccp84Af

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:69 Identity:15/69 - (21%)
Similarity:32/69 - (46%) Gaps:6/69 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHYKLNYLADE-NGFQAQGEHLP 104
            |.|:::..|.:|.:.::.::.    .:...:.|....:..||....:.|.:|. |||.|....:|
  Fly    62 YKFAYDVQDSLSGDSKSQVEE----RDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVP 122

  Fly   105 QVEH 108
             ::|
  Fly   123 -LDH 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 10/55 (18%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 10/55 (18%)

Return to query results.
Submit another query.