DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Cpr78Cb

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_649299.2 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster


Alignment Length:81 Identity:27/81 - (33%)
Similarity:43/81 - (53%) Gaps:10/81 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AQILRYDNENMDSDG-YAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHYKLNY 89
            |:|..:.....|.:| :.::|:||:||.      ::..|:|.|.|.|..   :..|:|:..:..|
  Fly    39 ARITDFRVSPTDDEGVFKYAFKTSNGID------VQAAGSPLETIGIYS---YTSPEGVPIETRY 94

  Fly    90 LADENGFQAQGEHLPQ 105
            :|||.||...|.||||
  Fly    95 IADELGFHVVGRHLPQ 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 16/54 (30%)
Cpr78CbNP_649299.2 Chitin_bind_4 55..101 CDD:459790 16/54 (30%)

Return to query results.
Submit another query.