DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Cpr76Ba

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster


Alignment Length:69 Identity:17/69 - (24%)
Similarity:28/69 - (40%) Gaps:5/69 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHYKLNYLAD-ENGFQAQGEHLP 104
            |.|::    |:...:...:|......:...::|.......||....:.|.|| .|||||..:|:.
  Fly   100 YEFNY----GVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQATVKHVG 160

  Fly   105 QVEH 108
            ...|
  Fly   161 HASH 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 11/55 (20%)
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:459790 11/55 (20%)

Return to query results.
Submit another query.