DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Cpr73D

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001097627.1 Gene:Cpr73D / 39897 FlyBaseID:FBgn0036680 Length:597 Species:Drosophila melanogaster


Alignment Length:62 Identity:16/62 - (25%)
Similarity:24/62 - (38%) Gaps:10/62 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DSDGYAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHYKLNYLADE-NGFQ 97
            |...|:|||.|.|....||.         :....|:|...::...|..:.:.|.|.. .||:
  Fly   123 DDPSYSFSFRTPDQSRSEEN---------DSGNRIRGLYSYLDDVGERHSVRYAAGAGTGFE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 13/55 (24%)
Cpr73DNP_001097627.1 Chitin_bind_4 127..174 CDD:459790 13/55 (24%)
Chitin_bind_4 <223..257 CDD:459790
SASA 491..>579 CDD:427409
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.