DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Cpr67Fb

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster


Alignment Length:97 Identity:32/97 - (32%)
Similarity:46/97 - (47%) Gaps:10/97 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILVSFCACSSNATD--TAQILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEAIAIQ 72
            ||:..|...:..|.|  .|:..:|.||......|::.:.||:||..:|...        ..:...
  Fly     6 LIISLFLVAAIRAADESQAETTKYRNEIKPDGSYSWEYGTSNGIDAQESGV--------GGVQAA 62

  Fly    73 GSVHWVGPDGIHYKLNYLADENGFQAQGEHLP 104
            |||.:..|||...:|.|.|||||::..|.|||
  Fly    63 GSVSYAAPDGTPIQLEYTADENGYRPTGAHLP 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 18/54 (33%)
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:459790 18/54 (33%)

Return to query results.
Submit another query.