DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Cpr65Ea

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster


Alignment Length:99 Identity:30/99 - (30%)
Similarity:44/99 - (44%) Gaps:15/99 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILVSFCACSSNATDTAQILRYDNENMDSDG-YAFSFETSDGISREERATLKNPGTPEEAIA--- 70
            |::|:...|:..|......:.....|.|:|| ||:..|.:.||.           ..||.:|   
  Fly     5 LLVVALFGCALAAPLNDDTITKFLANQDTDGTYAYDIEQASGIQ-----------IKEEGLAGHE 58

  Fly    71 IQGSVHWVGPDGIHYKLNYLADENGFQAQGEHLP 104
            ..||..::.|:||..::.|.|||.||..|...||
  Fly    59 AHGSYSYISPEGIPVQVVYTADEFGFHPQSNLLP 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 17/57 (30%)
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:459790 17/57 (30%)

Return to query results.
Submit another query.