DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Cpr65Az

DIOPT Version :9

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:79 Identity:34/79 - (43%)
Similarity:50/79 - (63%) Gaps:3/79 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ILRYDNENMDSDG-YAFSFETSDGISREERATLKNPGTP-EEAIAIQGSVHWVGPDGIHYKLNYL 90
            |::.::: :::|| |.:.:||.:||..||...|||.|.. .||...:||..:..|:|....|.|:
  Fly   116 IIKLESK-VNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYI 179

  Fly    91 ADENGFQAQGEHLP 104
            |||||||.||:|||
  Fly   180 ADENGFQPQGDHLP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:278791 23/55 (42%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 23/55 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450052
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.