DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Lcp65Ad

DIOPT Version :9

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001261466.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster


Alignment Length:102 Identity:46/102 - (45%)
Similarity:63/102 - (61%) Gaps:1/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLLFGLILVSFCACSSNATDTAQILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEA 68
            :.:.|..||....|........||:||:|::.: .:||.|:.|||||.|.:|...||:.||..||
  Fly     5 IAIAFTCILACSLAAPPAIQQDAQVLRFDSDVL-PEGYKFAVETSDGKSHQEEGQLKDVGTDHEA 68

  Fly    69 IAIQGSVHWVGPDGIHYKLNYLADENGFQAQGEHLPQ 105
            |.::||..:||.||..|.:.|||||||||.:|.|||:
  Fly    69 IVVRGSYAYVGDDGQTYSIQYLADENGFQPEGAHLPR 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:278791 29/54 (54%)
Lcp65AdNP_001261466.1 Chitin_bind_4 41..96 CDD:278791 29/54 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27015
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.