DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Cpr64Ab

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster


Alignment Length:113 Identity:20/113 - (17%)
Similarity:36/113 - (31%) Gaps:32/113 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RAIYIHEHTKRLEDTFLSRENTTHR--TMEKSTRTLFITIVITSMLLGFGNSDLAQDREECTNQL 80
            :::|......|.|....|.....|:  |.:|..||            .|..|..::.::|.....
  Fly   106 QSVYATLSNPRGEKRGTSAREMEHKIPTPKKEART------------DFNTSPASKQKQELIKGA 158

  Fly    81 IELSTCIPYVGGDAKAPTKDCCAGFGQVIRKSEKCVCILVRDKDDPQL 128
            :|        ....:|.:.|.....|:....          |::||:|
  Fly   159 VE--------DNKGEACSDDVQDNKGEAYND----------DEEDPEL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 9/56 (16%)
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.