DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Cpr49Ah

DIOPT Version :9

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster


Alignment Length:78 Identity:28/78 - (35%)
Similarity:42/78 - (53%) Gaps:1/78 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEAIAIQ-GSVHWVGPDGIHYKLNYLA 91
            |::|:.|..|...|...:||.:.|..||...||:..|....:.:| |...:..|:|....:.|.|
  Fly    53 IIKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTA 117

  Fly    92 DENGFQAQGEHLP 104
            |||||:|.|:|:|
  Fly   118 DENGFRATGDHIP 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:278791 18/55 (33%)
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:395303 18/55 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.