DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Cpr49Ab

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster


Alignment Length:77 Identity:30/77 - (38%)
Similarity:49/77 - (63%) Gaps:2/77 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHYKLNYLAD 92
            |:|.: ::::.|||.:.:||.:||..||...::.. |.||.:..:|...:.|||||.|:::|:||
  Fly   161 IIRQE-DDVEVDGYHYLWETENGILGEESGRIEKL-TEEEGLRSKGFYEYTGPDGILYRVDYVAD 223

  Fly    93 ENGFQAQGEHLP 104
            :|||.....|||
  Fly   224 DNGFVPSAAHLP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 21/54 (39%)
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 21/54 (39%)

Return to query results.
Submit another query.