DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Lcp4

DIOPT Version :9

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001260804.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster


Alignment Length:106 Identity:27/106 - (25%)
Similarity:45/106 - (42%) Gaps:25/106 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFGLILVSFCACSSNATDTAQILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEAIAI 71
            :|.::||........|.:..::....|: :.:||:.......:|                .|.:.
  Fly     1 MFKILLVCALVALVAANENPEVKELVND-VQADGFVSKLVLDNG----------------SAASA 48

  Fly    72 QGSVH--------WVGPDGIHYKLNYLADENGFQAQGEHLP 104
            .|.||        ||.|:|.|.:::|.|||||:|.|.:.||
  Fly    49 TGDVHGNIDGVFEWVSPEGEHVRVSYKADENGYQPQSDLLP 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:278791 15/62 (24%)
Lcp4NP_001260804.1 Chitin_bind_4 40..81 CDD:278791 15/56 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439225
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.