DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Pcp

DIOPT Version :9

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster


Alignment Length:94 Identity:30/94 - (31%)
Similarity:48/94 - (51%) Gaps:13/94 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SFCACSSNATDTAQILRYDNENMDSDG-YAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHW 77
            |:...|...|.|.|    ::..::.|| |.:::|||:|||..:...        ..:|:||...:
  Fly    21 SYIPDSDRNTRTLQ----NDLQVERDGKYRYAYETSNGISASQEGL--------GGVAVQGGSSY 73

  Fly    78 VGPDGIHYKLNYLADENGFQAQGEHLPQV 106
            ..|:|....:||:|||.|:...|.|:|||
  Fly    74 TSPEGEVISVNYVADEFGYHPVGAHIPQV 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:278791 17/54 (31%)
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:278791 17/54 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439223
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.