DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and Cpr23B

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster


Alignment Length:65 Identity:15/65 - (23%)
Similarity:30/65 - (46%) Gaps:5/65 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHYKLNYLADE-NGFQAQGEHLP 104
            |:|::..:|..:.:    :|......:...::|....:.|||....:.|.||: :||.|....:|
  Fly   157 YSFNYAVNDASTGD----IKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTADDVHGFNAVVNRVP 217

  Fly   105  104
              Fly   218  217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 11/55 (20%)
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:459790 11/55 (20%)

Return to query results.
Submit another query.