DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and LOC3290497

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:XP_551141.2 Gene:LOC3290497 / 3290497 VectorBaseID:AGAMI1_005151 Length:712 Species:Anopheles gambiae


Alignment Length:74 Identity:23/74 - (31%)
Similarity:36/74 - (48%) Gaps:9/74 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AQILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHYKLNYL 90
            ||...||    .:..|:||:..||.::.:.::..::    .....:|||...|.|||....::|.
Mosquito    55 AQPEEYD----ANPHYSFSYGISDALTGDSKSQQES----RSGDVVQGSYSVVDPDGTKRTVDYT 111

  Fly    91 AD-ENGFQA 98
            || .|||.|
Mosquito   112 ADPHNGFNA 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 16/55 (29%)
LOC3290497XP_551141.2 None

Return to query results.
Submit another query.