DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and CG15756

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster


Alignment Length:83 Identity:21/83 - (25%)
Similarity:38/83 - (45%) Gaps:4/83 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TDTAQIL--RYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHY 85
            |:|:..|  .:|..::|.. |.|.::..:|.:|.|||... |...:..:|.:|......|:..:.
  Fly    89 TETSPRLVDSFDQRSLDGQ-YEFRYQLDNGNTRYERAYWL-PVGKDLVLAKKGYYSVPLPNDKYS 151

  Fly    86 KLNYLADENGFQAQGEHL 103
            .:.|.||..|:....:.|
  Fly   152 TVFYTADHRGYHVDMQTL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 14/54 (26%)
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:459790 14/54 (26%)

Return to query results.
Submit another query.