DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and LOC1279296

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:XP_318997.6 Gene:LOC1279296 / 1279296 VectorBaseID:AGAMI1_012778 Length:386 Species:Anopheles gambiae


Alignment Length:78 Identity:34/78 - (43%)
Similarity:51/78 - (65%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHYKLNYLA 91
            :|:.|:|.|.....|.:|:||::||..:|:..:||.|:..|..::|||..:..|||....:.|:|
Mosquito   170 EIISYENMNNGDGTYKYSYETANGIKVQEQGEIKNKGSDNEIPSVQGSYSYTAPDGQVITVTYIA 234

  Fly    92 DENGFQAQGEHLP 104
            ||||||.||:|||
Mosquito   235 DENGFQPQGDHLP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 22/54 (41%)
LOC1279296XP_318997.6 None

Return to query results.
Submit another query.