DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and LOC1276669

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:XP_316039.1 Gene:LOC1276669 / 1276669 VectorBaseID:AGAMI1_000057 Length:109 Species:Anopheles gambiae


Alignment Length:102 Identity:45/102 - (44%)
Similarity:66/102 - (64%) Gaps:2/102 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLF-GLILVSFCACSSNATD-TAQILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEA 68
            ||| ||:.:.:.|....|.: .||:|:|:|::...|||.|.|:||:||.|:|:|.||.......|
Mosquito     8 LLFAGLLALGYAAPRPGAEEKDAQLLKYENDHNGIDGYNFQFDTSNGIQRQEQAQLKQFDDENAA 72

  Fly    69 IAIQGSVHWVGPDGIHYKLNYLADENGFQAQGEHLPQ 105
            :.::||..:.|.||..|.:||:|||||||.:..|||:
Mosquito    73 LVVRGSYSFTGDDGQVYTVNYVADENGFQPEAPHLPK 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 25/54 (46%)
LOC1276669XP_316039.1 Chitin_bind_4 45..100 CDD:459790 25/54 (46%)

Return to query results.
Submit another query.