DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and LOC1276668

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:XP_316038.1 Gene:LOC1276668 / 1276668 VectorBaseID:AGAMI1_010311 Length:104 Species:Anopheles gambiae


Alignment Length:101 Identity:44/101 - (43%)
Similarity:67/101 - (66%) Gaps:1/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLFGLILVSFCACSSNATDTAQILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEAIA 70
            ::|..:|....|..::..| ||:|:|:|:|:..|||.|.:|||:.|:|.|.|.|||.|....|:.
Mosquito     5 VVFAAVLAVALAAPADERD-AQVLKYENDNLGVDGYNFQYETSNNINRAETAELKNFGDDVAALV 68

  Fly    71 IQGSVHWVGPDGIHYKLNYLADENGFQAQGEHLPQV 106
            ::||..:.||||..|.:||:|||||||.:..|:|::
Mosquito    69 VRGSYSYTGPDGQVYTVNYVADENGFQPEAPHIPRL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 27/54 (50%)
LOC1276668XP_316038.1 Chitin_bind_4 39..94 CDD:459790 27/54 (50%)

Return to query results.
Submit another query.