DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Aw and LOC1270224

DIOPT Version :10

Sequence 1:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster
Sequence 2:XP_308903.5 Gene:LOC1270224 / 1270224 VectorBaseID:AGAMI1_004499 Length:230 Species:Anopheles gambiae


Alignment Length:100 Identity:22/100 - (22%)
Similarity:39/100 - (39%) Gaps:20/100 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVSFCACSSNATDTAQILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEAIAIQGSVH 76
            :::..||.: ...:||...|..::..:..:...:|..||      ..:|...|..||        
Mosquito   107 ILALIACLA-IVASAQYHGYGVKDPHTGDHKTQWEVRDG------DVVKGQYTLHEA-------- 156

  Fly    77 WVGPDGIHYKLNYLAD-ENGFQAQGEHLPQVEHSS 110
                ||....::|.:| .|||:|..:.:....|.|
Mosquito   157 ----DGTERVVDYKSDGHNGFEADVKKVGHAHHPS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 12/55 (22%)
LOC1270224XP_308903.5 None

Return to query results.
Submit another query.