DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZKSCAN4 and CG14710

DIOPT Version :9

Sequence 1:NP_061983.2 Gene:ZKSCAN4 / 387032 HGNCID:13854 Length:545 Species:Homo sapiens
Sequence 2:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster


Alignment Length:364 Identity:96/364 - (26%)
Similarity:153/364 - (42%) Gaps:66/364 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   152 LCCKMALLTQTQGS-------QSSQCQPMKALFK--HESLGSQPLHDRVLQVPGLAQGGCCREDA 207
            :|....:..:|..|       |:|..:.|..|::  |..||::  :....::..:.:|...:||.
  Fly    73 MCLNSQVYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTE--NQEKEEITAIEEGDEQQEDQ 135

Human   208 MVASRLTPGSQGLL---------KMEDVALTLTPGWTQLDSSQVNLYRDEKQENHSSLVSLGGEI 263
                     ||.:|         .:|:.....|....|:..|.::.|.|::|  ...|:...||:
  Fly   136 ---------SQEVLDFNGFIINESIEEDEEPNTESPEQILISHMDSYVDDQQ--MEELIDDKGEL 189

Human   264 QTKSRDLPPVKKLPEKEHGKICHLREDI---------------AQIPTHAEAGEQEGRLQRKQKN 313
               ..:|.......|.|:|.     |::               .|.|......:.|.:.:||..|
  Fly   190 ---VEELSNANTFYEVEYGD-----EELLMSSAPSPHPSFKMDKQKPGRPRKPDAELKFKRKDIN 246

Human   314 A--IGSR-------RHYCHECGKSFAQSSGLTKHRRIHTGEKPYECEDCGKTFIGSSALVIHQRV 369
            |  .|::       :..|..||..|.:.|..|.|...|:..||::||.|.|:|.....|..|.|.
  Fly   247 AKERGNQPKCKEEEKFMCILCGNVFYKKSVFTAHMMTHSEYKPHQCEICNKSFRQMGELRAHIRR 311

Human   370 HTGEKPYECEECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFSQSCSLLEHHKIHTGEKPYQC 434
            |||::||:|..|.:.|...|..::|:|.||..:||.|.:|||||:.:..|..|...|:.:|.|.|
  Fly   312 HTGDRPYKCMYCDRHFYDRSERVRHERVHTNTRPYACQECGKTFTHTAILKNHILSHSAQKNYNC 376

Human   435 NMCGKAFRRNSHLLRHQR--IHGDKNVQN-PEHGESWES 470
            .:|.|:|.....|..|.:  .|.:|..|. |...|..||
  Fly   377 GICCKSFTLLHQLKAHLQTLTHRNKMEQTIPSSPEMLES 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZKSCAN4NP_061983.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..55
SCAN 49..160 CDD:128708 1/7 (14%)
KRAB 221..281 CDD:214630 13/68 (19%)
zf-C2H2 320..342 CDD:306579 7/21 (33%)
C2H2 Zn finger 322..342 CDD:275368 7/19 (37%)
zf-H2C2_2 335..357 CDD:316026 9/21 (43%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
COG5048 <374..544 CDD:227381 36/100 (36%)
C2H2 Zn finger 378..398 CDD:275368 6/19 (32%)
C2H2 Zn finger 406..426 CDD:275368 8/19 (42%)
C2H2 Zn finger 434..454 CDD:275368 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 455..480 6/17 (35%)
C2H2 Zn finger 489..509 CDD:275368
C2H2 Zn finger 517..537 CDD:275368
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 1/9 (11%)
COG5048 <261..395 CDD:227381 50/133 (38%)
C2H2 Zn finger 264..284 CDD:275368 7/19 (37%)
zf-C2H2 290..312 CDD:278523 8/21 (38%)
C2H2 Zn finger 292..312 CDD:275368 8/19 (42%)
zf-H2C2_2 304..327 CDD:290200 10/22 (45%)
C2H2 Zn finger 320..340 CDD:275368 6/19 (32%)
zf-H2C2_2 335..357 CDD:290200 12/21 (57%)
C2H2 Zn finger 348..368 CDD:275368 8/19 (42%)
C2H2 Zn finger 376..395 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.