DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag1 and Cpr65Ax2

DIOPT Version :9

Sequence 1:NP_477273.1 Gene:Lcp65Ag1 / 38703 FlyBaseID:FBgn0020638 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_001261467.1 Gene:Cpr65Ax2 / 59157 FlyBaseID:FBgn0042118 Length:102 Species:Drosophila melanogaster


Alignment Length:105 Identity:63/105 - (60%)
Similarity:77/105 - (73%) Gaps:3/105 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIVFVALFAVALAAPAAEEPTIVRSESDVGPESFKYDWETSDGQAAQAVGQLNDIGTENEAI 65
            |||.||..||||||||||..|   ::||:|:||.:::.|..|||||.:....|.|.:.|||.|||
  Fly     1 MKFAIVLFALFAVALAAPTVE---VLRSDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAI 62

  Fly    66 SVSGSYRFIADDGQTYQVNYIADKNGFQPQGAHLPVAPVA 105
            |..||:.::..|||||.|.|:||:||||||||||||||||
  Fly    63 STHGSFSYVGPDGQTYTVTYVADENGFQPQGAHLPVAPVA 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag1NP_477273.1 Chitin_bind_4 37..92 CDD:306811 27/54 (50%)
Cpr65Ax2NP_001261467.1 Chitin_bind_4 34..89 CDD:278791 27/54 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466916
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 1 1.000 - - H43214
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.