powered by:
Protein Alignment Lcp65Ag1 and Cpr100A
DIOPT Version :9
Sequence 1: | NP_477273.1 |
Gene: | Lcp65Ag1 / 38703 |
FlyBaseID: | FBgn0020638 |
Length: | 105 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_651829.1 |
Gene: | Cpr100A / 43657 |
FlyBaseID: | FBgn0039805 |
Length: | 241 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 25/66 - (37%) |
Similarity: | 34/66 - (51%) |
Gaps: | 3/66 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 TSDGQAAQAVGQLNDIGTENEAISVS---GSYRFIADDGQTYQVNYIADKNGFQPQGAHLPVAPV 104
:.||:...|..|.:.|..:.|..:.. |||.::...||...::|.|.|||||..|.|||.||.
Fly 36 SGDGKFGAAYEQEDGINFKEETDADGTRHGSYSYLDPTGQRRTISYTAGKNGFQASGDHLPQAPP 100
Fly 105 A 105
|
Fly 101 A 101
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.