DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag1 and Cpr100A

DIOPT Version :9

Sequence 1:NP_477273.1 Gene:Lcp65Ag1 / 38703 FlyBaseID:FBgn0020638 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_651829.1 Gene:Cpr100A / 43657 FlyBaseID:FBgn0039805 Length:241 Species:Drosophila melanogaster


Alignment Length:66 Identity:25/66 - (37%)
Similarity:34/66 - (51%) Gaps:3/66 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TSDGQAAQAVGQLNDIGTENEAISVS---GSYRFIADDGQTYQVNYIADKNGFQPQGAHLPVAPV 104
            :.||:...|..|.:.|..:.|..:..   |||.::...||...::|.|.|||||..|.|||.||.
  Fly    36 SGDGKFGAAYEQEDGINFKEETDADGTRHGSYSYLDPTGQRRTISYTAGKNGFQASGDHLPQAPP 100

  Fly   105 A 105
            |
  Fly   101 A 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag1NP_477273.1 Chitin_bind_4 37..92 CDD:306811 15/51 (29%)
Cpr100ANP_651829.1 Chitin_bind_4 44..88 CDD:278791 13/43 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.